Publication date: April 2018
Source:Archives of Oral Biology, Volume 88
Author(s): Eiichi Saitoh, Takuya Sega, Akane Imai, Satoko Isemura, Tetsuo Kato, Akihito Ochiai, Masayuki Taniguchi
ObjectivesThe NCBI gene database and human-transcriptome database for alternative splicing were used to determine the expression of mRNAs for P-B (SMR3B) and variant form of P-B. The translational product from the former mRNA was identified as the protein named P-B, whereas that from the latter has not yet been elucidated. In the present study, we investigated the expression of P-B and its variant form at the protein level.DesignTo identify the variant protein of P-B, (1) cationic proteins with a higher isoelectric point in human pooled whole saliva were purified by a two dimensional liquid chromatography; (2) the peptide fragments generated from the in-solution of all proteins digested with trypsin separated and analyzed by MALDI-TOF-MS; and (3) the presence or absence of P-B in individual saliva was examined by 15% SDS-PAGE.ResultsThe peptide sequences (I37PPPYSCTPNMNNCSR52, C53HHHHKRHHYPCNYCFCYPK72, R59HHYPCNYCFCYPK72 and H60HYPCNYCFCYPK72) present in the variant protein of P-B were identified. The peptide sequence (G6PYPPGPLAPPQPFGPGFVPPPPPPPYGPGR36) in P-B (or the variant) and sequence (I37PPPPPAPYGPGIFPPPPPQP57) in P-B were identified. The sum of the sequences identified indicated a 91.23% sequence identity for P-B and 79.76% for the variant. There were cases in which P-B existed in individual saliva, but there were cases in which it did not exist in individual saliva.ConclusionsThe variant protein is produced by excising a non-canonical intron (CC-AC pair) from the 3′-noncoding sequence of the PBII gene. Both P-B and the variant are subject to proteolysis in the oral cavity.
http://ift.tt/2BY1iCP
Αρχειοθήκη ιστολογίου
-
►
2020
(289)
- ► Φεβρουαρίου (28)
-
►
2019
(9071)
- ► Δεκεμβρίου (19)
- ► Σεπτεμβρίου (54)
- ► Φεβρουαρίου (3642)
- ► Ιανουαρίου (3200)
-
▼
2018
(39872)
- ► Δεκεμβρίου (3318)
- ► Σεπτεμβρίου (3683)
-
▼
Φεβρουαρίου
(2693)
-
▼
Φεβ 05
(110)
- Development and Validation of the Mastocytosis Act...
- Baseline neutrophil to lymphocyte ratio combined w...
- Wide skin markings pattern - melanoma descriptor o...
- Application of in vivo reflectance confocal micros...
- Hyaluronan metabolism enhanced during epidermal di...
- Levocarnitine for vismodegib-associated muscle spa...
- Factors associated with delayed referral for infan...
- Comparison of fungal fluorescent staining and ITS ...
- Molecular genetic analyses of human endogenous ret...
- Studying the effect of systemic and biological dru...
- Use of Medical Photography Among Dermatologists: A...
- Herpes zoster at the vaccination site in immunized...
- Das Recht am eigenen Bild
- Rhinoplastik
- Endoskopisch ausgeführte Tympanoplastik mit Vorteilen
- Fragen für die Facharztprüfung
- Erhöhtes Schlaganfallrisiko nach Neck Dissection?
- Medikamentöse Therapie des Schilddrüsenknotens
- Tympanoplastik Typ I im frühen Kindesalter erfolgs...
- Aktueller Status der Therapie und Prophylaxe des O...
- Durchführung und Interpretation der FEES (Fiberopt...
- „Das Thema künstliche Intelligenz ist in der Radio...
- Seltener Nasennebenhöhlen Tumor
- Kommentar der Schriftleitung
- Tropical Dermatology, 2nd ed
- Response to: baseline asthma burden, comorbidities...
- Biologics in allergic and immunologic diseases: pr...
- New Research Suggests Your Immune System Can Prote...
- MicroRNA-186 serves as a tumor suppressor in oral ...
- An in vitro study on the influence of viscosity an...
- Comparative proteomic profiling of human dental pu...
- Maresin 1 regulates autophagy and inflammation in ...
- The PBII gene of the human salivary proline-rich p...
- Third molar agenesis as a potential marker for cra...
- Structure, property, and function of sheepshead (A...
- Differentiation of stem cells from human deciduous...
- Effects of sub-minimum inhibitory concentrations o...
- Proteomics and immunohistochemistry identify the e...
- Causes and treatments for nasolabial folds
- Cochlear implants and 1.5 T MRI scans: the effect ...
- Cavernous sinus involvement is not a risk factor f...
- Cavernous sinus involvement is not a risk factor f...
- Agminated Spitz naevi or metastatic spitzoid melan...
- Endoscope-assisted conservative resection and reco...
- Sacrifice and extracranial reconstruction of the c...
- Oral retinoids and depression: reply from the authors
- Ficlatuzumab With or Without Cetuximab in Treating...
- Treatment of Metastatic Soft Tissue Sarcoma (STS) ...
- Satisfaction and Quality of Life Comparison Betwee...
- Phase II Study of Atezolizumab + FLOT vs. FLOT Alo...
- Docetaxel and Radiation Therapy in Treating Patien...
- Ex-Vivo Expanded Allogeneic NK Cells For The Treat...
- Brain Stimulation For Cancer Smokers
- Development of a pediatric ebola predictive score,...
- Difficult communication in Radiology: a training c...
- Pathogenesis of HIV-1 and Mycobacterium tuberculos...
- Masculinities on the Continuum of Structural Viole...
- Carrier Phase Estimation in Dispersion-Unmanaged O...
- Comparative and Transnational History: Central Eur...
- GLS loss of function causes autosomal recessive sp...
- Surgical and Minimally Invasive Therapies for the ...
- EACH in the UK: a network for healthcare communica...
- Determing the minimal clinically important differe...
- Multivariate calibration of energy-dispersive X-ra...
- End of the Road for Adjunctive Vitamin D Therapy f...
- Acute kidney injury, long-term renal function and ...
- UCL Communication Clinic
- Management of non-visualization following dynamic ...
- Quantum noise spectra for periodically driven cavi...
- Empirically Determined Vascular Smooth Muscle Cell...
- Optical coherence tomography angiography: a review...
- No association between ACTN3 R577X and ACE I/D pol...
- 1985, Scientists can’t do science alone, they need...
- Cochlear implants and 1.5 T MRI scans: the effect ...
- Monilethrix: A case report imaged by trichoscopy, ...
- BRCA Mutations: Cancer Risk and Genetic Testing
- Parental Enrollment in Medicaid Yields Increase in...
- Initial Observations on Lighting Situations in The...
- Pulmonary 18F-FDG uptake helps refine current risk...
- MEASUREMENTS OF COSMIC-RAY PROTON AND HELIUM SPECT...
- COMSOL ANALYSIS OF WHEELCHAIR PUSHRIM SIX DOF LOAD...
- Characterization of cyclically fully commutative e...
- Editorial Comment
- Incompressible limit of the Navier—Stokes model wi...
- The 'I' in fibromyalgia - How does fibromyalgia sh...
- Making internal fixation work with limited bone stock
- She knows that she will not come back: tracing pat...
- Molecular characteristics of long-term epilepsy-as...
- Molecular evolution of HIV-1 integrase during the ...
- Effectiveness of Mass Media Campaigns to Reduce Al...
- Absence of sex differences in mental rotation perf...
- Predicting Flux And Pressure Relationships of Larg...
- No evidence for accelerated ageing-related brain p...
- Effects of ambroxol on the autophagy-lysosome path...
- Encountering pain: hearing, seeing, speaking - a c...
- Expansionism, Extremism and Exceptionalism in Life...
- Bottleneck: A Generalized, Flexible, and Extensibl...
- Nasoseptal Perforation: from Etiology to Treatment
- Physician turnover effect for in-hospital cardiopu...
- Outcome of portopulmonary hypertension after liver...
-
▼
Φεβ 05
(110)
- ► Ιανουαρίου (3198)
-
►
2017
(41099)
- ► Δεκεμβρίου (3127)
- ► Σεπτεμβρίου (2173)
-
►
2016
(13807)
- ► Δεκεμβρίου (700)
- ► Σεπτεμβρίου (600)
- ► Φεβρουαρίου (1350)
- ► Ιανουαρίου (1400)
-
►
2015
(1500)
- ► Δεκεμβρίου (1450)
Ετικέτες
Εγγραφή σε:
Σχόλια ανάρτησης (Atom)
Δεν υπάρχουν σχόλια:
Δημοσίευση σχολίου